PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010550978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 1039aa    MW: 115773 Da    PI: 9.9167
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010550978.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.67e-094379340
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                      WT+ E e+++da +++G + Wk++a+ + ++R+ +++
   XP_010550978.1 43 QWTKGELERFYDAYRKHGQD-WKKVAASVRNNRSVEMV 79
                     6*****************99.*********99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.193993IPR017884SANT domain
SuperFamilySSF466895.31E-84289IPR009057Homeodomain-like
PfamPF002493.8E-74380IPR001005SANT/Myb domain
CDDcd001679.08E-44486No hitNo description
SMARTSM011357.7E-59619720IPR033471DIRP domain
PfamPF065845.5E-32619719IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1039 aa     Download sequence    Send to blast
MAPGRKSRSV NKRFSNETSP EKDVWNSSKS KQRKKLSDKL GPQWTKGELE RFYDAYRKHG  60
QDWKKVAASV RNNRSVEMVE ALFYMNRAYL SLPEGTASVA GLIAMMTDHY SVMDGSDSEG  120
EGHAASGVRK KYQKGKRTKE SREETNIPHS IASADGCLSF LKQAQAFGSQ RRATGKRTPR  180
FPVPSSYRRE DREGSTPLSK RARKPVDNDD VAHFVALALT DASKRGGSES PYRRTEHSDS  240
SPIKSWGKMS QAREAQSKLR DSSMCEEWVE GNRERKRKKG GSDRDATSLM DMEGVGTVEV  300
LRRGKKFYGK KAKVEEAKGI DSDDSGEACS ATEGLRSKSQ KGKVDVEASR GKFSPHGPKK  360
RNKKLQFGDE FDALQALAEL SASMLPAALM ESESSAQLKE EGTANDMDEK SSTPEATSTS  420
HHGEKSKQVE PEESVLHAIS AVENTKYRKP KSSRQASADG IAGPAGKQQQ QPSGTLRRRR  480
KPKVLDAEPP TDSNQNKSTL MKESAHDENA KSVVKTKRTV QVPAQSKQLK TVKTLEESSS  540
ASDKKTLPVS ASASLPQKPQ NRRKMGLKKT LQERVKFSET TPKASYVNES LLEHELLKEK  600
LSSCLSYPLA RRRCIFEWFY SAIDYPWFAK MEFVDYLNHV GLGHVPRLTR LEWSVIKSSL  660
GRPRRFSERF LQEERDKLKQ YRESVRKHYT ELRAGAREGL PTDLARPLSV GNKVIAIHPK  720
TREIHDGKIL TVDHNKCSVL FDRDDLGVEF VKDIDCMPLN PLEYMPEGLR RQIDMCMAIS  780
KEAHLNRHPN FEGSVIFPSS VLENASLYMK QGDTNGPILQ AKILATNTTS PQQATNNHPF  840
ITTFSKAREV EIQRALAVQR SLNEKEIEPE MLEIVKGSKS RAQAMVDAAI KAASSVKEGE  900
DASKKIQEAI DSIGKHLPLH SSMVPGVKHQ EHANGSLDHH LSQSPSDALE SLVNGSISQD  960
GSGKNEGQMP SELISSCVAT WLMIQMCTER QYPPADVAQL IDTAVMSLHP RCPQNLPIYR  1020
EIQTCMGRIK TQILALVPT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1274278RKRKK
2475481LRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550978.10.0PREDICTED: protein ALWAYS EARLY 2-like isoform X2
SwissprotQ6A3330.0ALY2_ARATH; Protein ALWAYS EARLY 2
TrEMBLV4M3T70.0V4M3T7_EUTSA; Uncharacterized protein
STRINGAT3G05380.20.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.21e-151DNA binding